Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0B0PDH6

dbSWEET id: dbswt_446

Accession:   A0A0B0PDH6

Uniprot status:   Unreviewed

Organism:   Gossypium arboreum

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Malvales ⇒ Malvaceae ⇒ Malvoideae ⇒ Gossypium.

Sequence Information back to top


Sequence length:   300

Substrate Binding Site:   TNWN           CVV:   448       CHI:   -8.6

Selectivity Filter:   VSMN           CVV:   398       CHI:   1.8

Fasta sequence:

>tr|A0A0B0PDH6|A0A0B0PDH6_GOSAR|Unreviewed|Gossypium_arboreum|300
MASLSFIIGIIGNIISILVFASPIKTFWWVVKKKSTKNYKGVPYITTLLSTSLWTFYGIM
NPDGLLVVTVNGAGAIFQLIYVILFLVYAPKDKKVKTAKLVAILDVGFLGAVIAVTLLAF
HGTMRLTFVGIICAGLTIGMYASPLSVMRTVIKTKSVEYMPFLLSFFLFLNAGVWSAYAL
LVKDIYIGVPNAIGFILGSAQLILYLMYNNKKSAEAVEEEEGGGGGGSAHLVKGGIEMHS
VEDNLNNRSLNKWKSLPKPNFSRQHSMQKIIKTVSLTPYELQSSWPLHESDIEEGNPDLP

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   210

Alignment file: A0A0B0PDH6.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0B0PDH6_inward.pdb

Procheck score ⇒ Ramachandran plot: 92.3% favored    4.9% allowed    1.6% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0B0PDH6_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.9% favored    5.5% allowed    1.6% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0B0PDH6_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.4% favored    5.5% allowed    .5% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur