Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0B0P9Y2

dbSWEET id: dbswt_88

Accession:   A0A0B0P9Y2

Uniprot status:   Unreviewed

Organism:   Gossypium arboreum

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Malvales ⇒ Malvaceae ⇒ Malvoideae ⇒ Gossypium.

Sequence Information back to top


Sequence length:   289

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   VSVS           CVV:   356       CHI:   6.8

Fasta sequence:

>tr|A0A0B0P9Y2|A0A0B0P9Y2_GOSAR|Unreviewed|Gossypium_arboreum|289
MAVMADHHSLAVVFGILGNIISVLVFLAPVPTFCRIYKKKSTESFQSLPYQVALFSCMLW
LYYALIKKGAFLLITINSFGCVVETIYISMFLAYASKNSRMSAMKLFISMNLGLFSFILI
LTHFLLKSSIRIQVLGWICVAISVSVFAAPLNIMARVIRTKSVEFMPFTLSFFLTLSAVM
WFAYGLFIKDLCVALPNVLGFILGMLQMLLYAIYRHSEKVNIEEKKLPAEQMKSINVVLT
TLGASEVHPVVLDIHTDDTKEEDNKNNEPTGEPDKQTDVKMEDANESPV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   4     Model end:   216

Alignment file: A0A0B0P9Y2.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0B0P9Y2_inward.pdb

Procheck score ⇒ Ramachandran plot: 95.4% favored    3.1% allowed    1.0% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0B0P9Y2_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.8% favored    4.6% allowed    1.0% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0B0P9Y2_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.8% favored    4.1% allowed    2.1% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur