| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0B0MPX3
dbSWEET id: dbswt_196
Accession: A0A0B0MPX3
Uniprot status: Unreviewed
Organism: Gossypium arboreum
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Malvales ⇒ Malvaceae ⇒ Malvoideae ⇒ Gossypium.
Sequence Information back to top
Sequence length: 273
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSVG CVV: 331 CHI: 7.2
Fasta sequence:
>tr|A0A0B0MPX3|A0A0B0MPX3_GOSAR|Unreviewed|Gossypium_arboreum|273
MALHLSWVFVFGILGNAVSFMVSLAPLPTFYQIFKKKTSEGFQSIPYVVSLFSAMLWIYY
ALLKKDAIFLITINTFCVFIQTFYIVTYFYYGPKKEKIVTVKLMLLFNVFGFGVIFLATY
FLKNPSLRLLILGYICMAFALAVFVAPLAIVRKVIKTKSVEYMPFTLSVFLTLGAVMWFF
YGLCLKDMNVAVPNILGFIFGVLQMILYAVYKNHPKKTVEESDPKLQLSDHPVVVVDVAK
LGSNVNAIIPNSTNSNNGGNNGGRTEGNAFSKV
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 213
Alignment file: A0A0B0MPX3.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0B0MPX3_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.7% favored 4.7% allowed .5% week 1.0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0B0MPX3_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.7% favored 4.7% allowed 1.6% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0B0MPX3_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.7% favored 5.8% allowed 1.0% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF22