Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0B0EKI9
dbSWEET id: dbswt_1344
Accession: A0A0B0EKI9
Uniprot status: Unreviewed
Organism: Candidatus Scalindua
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Planctomycetes ⇒ Planctomycetia ⇒ Candidatus Brocadiales ⇒ Candidatus Brocadiaceae ⇒ Candidatus Scalindua.
Sequence Information back to top
Sequence length: 87
Substrate Binding Site: LNLN CVV: 440 CHI: 0.6
Selectivity Filter: GGGG CVV: 192 CHI: -1.6
Fasta sequence:
>tr|A0A0B0EKI9|A0A0B0EKI9_9BACT|Unreviewed|Candidatus Scalindua|87
MEWKIVGIIAAICTTSGFIPQIIRGLRTKRLDDISPVMYILLIFGLSLWLSYGIHIEDMI
IIVANAFGVLFSIIIIVLRFKYMRQKA
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 4 Model end: 81 Inward Open: Template: 4X5M.pdb Model structure: A0A0B0EKI9_inward.pdb Alignment file: A0A0B0EKI9_inw.pir Procheck score ⇒ Ramachandran plot: 94.8% favored 3.0% allowed 2.2% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0B0EKI9_outward.pdb Alignment file: A0A0B0EKI9_out.pir Procheck score ⇒ Ramachandran plot: 94.8% favored 5.2% allowed .0% week .0% disallowed Occluded: Model structure: A0A0B0EKI9_occluded.pdb Alignment file: A0A0B0EKI9_occ.pir Procheck score ⇒ Ramachandran plot: 96.3% favored 3.7% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA