Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0B0EKI9

dbSWEET id: dbswt_1344

Accession:   A0A0B0EKI9

Uniprot status:   Unreviewed

Organism:   Candidatus Scalindua

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Planctomycetes ⇒ Planctomycetia ⇒ Candidatus Brocadiales ⇒ Candidatus Brocadiaceae ⇒ Candidatus Scalindua.

Sequence Information back to top


Sequence length:   87

Substrate Binding Site:   LNLN           CVV:   440       CHI:   0.6

Selectivity Filter:   GGGG           CVV:   192       CHI:   -1.6

Fasta sequence:

>tr|A0A0B0EKI9|A0A0B0EKI9_9BACT|Unreviewed|Candidatus Scalindua|87
MEWKIVGIIAAICTTSGFIPQIIRGLRTKRLDDISPVMYILLIFGLSLWLSYGIHIEDMI
IIVANAFGVLFSIIIIVLRFKYMRQKA

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   4     Model end:   81

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0B0EKI9_inward.pdb    Alignment file: A0A0B0EKI9_inw.pir

Procheck score ⇒ Ramachandran plot: 94.8% favored    3.0% allowed    2.2% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0B0EKI9_outward.pdb    Alignment file: A0A0B0EKI9_out.pir

Procheck score ⇒ Ramachandran plot: 94.8% favored    5.2% allowed    .0% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0B0EKI9_occluded.pdb    Alignment file: A0A0B0EKI9_occ.pir

Procheck score ⇒ Ramachandran plot: 96.3% favored    3.7% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur