Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0A9Y973
dbSWEET id: dbswt_1018
Accession: A0A0A9Y973
Uniprot status: Unreviewed
Organism: Lygus hesperus
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Paraneoptera ⇒ Hemiptera ⇒ Euhemiptera ⇒ Heteroptera ⇒ Panheteroptera ⇒ Cimicomorpha ⇒ Miridae ⇒ Mirini ⇒ Lygus.
Sequence Information back to top
Sequence length: 209
Substrate Binding Site: SNWN CVV: 428 CHI: -8.7
Selectivity Filter: QSFV CVV: 427 CHI: 2.7
Fasta sequence:
>tr|A0A0A9Y973|A0A0A9Y973_LYGHE|Unreviewed|Lygus_hesperus|209
MNQEEFKELIATCASVCQILQVLSGVLVCRKFMKKGSSNDVSPLPFICGTVSSFLWFLYG
TLIEDQAITLVNIFGVLFFSSYVAAYITFSSKKVTVMRQVLVVAVLTCCIFVYIRTLDDL
AEAKHKLGLVACGVSVSFFAAPLANLAHVIKAKSSESLPMPIIFMSMVVTLLWSAYGYIL
QDKFVAYPNMLAFLLSTFQMSLFLIYPSR
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 208
Alignment file: A0A0A9Y973.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0A9Y973_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.7% favored 6.3% allowed .0% week 1.0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0A9Y973_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.8% favored 4.2% allowed .5% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0A9Y973_occluded.pdb
Procheck score ⇒ Ramachandran plot: 89.0% favored 9.4% allowed .5% week 1.0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA