| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0A9HIG5
dbSWEET id: dbswt_57
Accession: A0A0A9HIG5
Uniprot status: Unreviewed
Organism: Arundo donax
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ PACMAD clade ⇒ Arundinoideae ⇒ Arundineae ⇒ Arundo.
Sequence Information back to top
Sequence length: 286
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|A0A0A9HIG5|A0A0A9HIG5_ARUDO|Unreviewed|Arundo_donax|286
MAGGLFSMEHPWASAFGILGNIVSFLVFLAPTPTFLRVYRKKSTEGFSSVPYVVALFSCA
LWILYALVKTNSSPLLTINAFGCVVESAYILLYLIYAPRPARLRTLAAFFLLNVAAFSLI
VAVTLNLVAEHHRVRVLGSICLAFSMAVFVAPMSVIFVVIRTKSAEFMPFSLSFFLTLSA
VAWFFYGLFTKDLYVALPNVGGFFFSCTQMVLYFCYRKPKASTAVLPTATATLGAVQPGA
EMELPVLGAALNAVAVLPECAVPVLAELQKMEQEVGSPRKGGVKAV
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 6 Model end: 218
Alignment file: A0A0A9HIG5.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0A9HIG5_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.3% favored 4.2% allowed .5% week 1.0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0A9HIG5_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.3% favored 4.7% allowed .5% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0A9HIG5_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.7% favored 4.7% allowed 2.6% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA