| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0A9DKZ6
dbSWEET id: dbswt_599
Accession: A0A0A9DKZ6
Uniprot status: Unreviewed
Organism: Arundo donax
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ PACMAD clade ⇒ Arundinoideae ⇒ Arundineae ⇒ Arundo.
Sequence Information back to top
Sequence length: 229
Substrate Binding Site: CNFN CVV: 413 CHI: -1.7
Selectivity Filter: LNMM CVV: 468 CHI: 4.1
Fasta sequence:
>tr|A0A0A9DKZ6|A0A0A9DKZ6_ARUDO|Unreviewed|Arundo_donax|229
MSSLYDIFCFAAGLAGNIFALALFLSPVPTFKRVLKAKSTEQFDGLPYLLSLLNCCICLW
YGLPWVSDGRLLVATVNGTGAVFQLAYISLFIFYADCRRTRLKITGLLALVACVFALIAH
ASVAFFDHPVRQQFVGAVSMASLISMFASPLAVMGLVIRTECVEFMPFYLSLSTFLMSAS
FAMYGLLLRDFFIYLPNGLGVILGATQLVLYAYYSRKWKGSDSSAPLLA
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 2 Model end: 216
Alignment file: A0A0A9DKZ6.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0A9DKZ6_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.2% favored 4.7% allowed .0% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0A9DKZ6_outward.pdb
Procheck score ⇒ Ramachandran plot: 95.3% favored 3.7% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0A9DKZ6_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.6% favored 7.4% allowed 1.1% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA