Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0A8J811

dbSWEET id: dbswt_1016

Accession:   A0A0A8J811

Uniprot status:   Unreviewed

Organism:   Nilaparvata lugens

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Paraneoptera ⇒ Hemiptera ⇒ Euhemiptera ⇒ Fulgoroidea ⇒ Delphacidae ⇒ Delphacinae ⇒ Nilaparvata.

Sequence Information back to top


Sequence length:   219

Substrate Binding Site:   SNWN           CVV:   428       CHI:   -8.7

Selectivity Filter:   QMLV           CVV:   467       CHI:   6.4

Fasta sequence:

>tr|A0A0A8J811|A0A0A8J811_NILLU|Unreviewed|Nilaparvata_lugens|219
MALEDYKDLVATVASVTTIAQFFSPVFICKEIIQKGNTKDIDAMPFIGGMVMSLLMLQHG
MILNDPAMIPVNVAGFTLNFTYFAIYYLYSHERDSLHGKLAKGVALTAILINYAQLENEK
NVEFRFGIIVTVLMLTLIGAPLLQLGDIIKRRSTKGLPFPLIFSGTVVTFLWLLYGIIIK
NVFIQFQNVVGFILCAIQLSLFAIFPNSSEDEDKKDKKN

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   207

Alignment file: A0A0A8J811.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0A8J811_inward.pdb

Procheck score ⇒ Ramachandran plot: 89.1% favored    8.7% allowed    2.2% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0A8J811_outward.pdb

Procheck score ⇒ Ramachandran plot: 89.6% favored    8.7% allowed    1.1% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0A8J811_occluded.pdb

Procheck score ⇒ Ramachandran plot: 88.0% favored    9.8% allowed    1.6% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF5

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur