| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0A7V317
dbSWEET id: dbswt_2046
Accession: A0A0A7V317
Uniprot status: Unreviewed
Organism: Candidatus Nitrosopelagicus
Kingdom: Archaea
Sequence Information back to top
Sequence length: 95
Substrate Binding Site: ANAN CVV: 326 CHI: -3.4
Selectivity Filter: GGGG CVV: 192 CHI: -1.6
Fasta sequence:
>tr|A0A0A7V317|A0A0A7V317_9ARCH|Unreviewed|Candidatus Nitrosopelagicus|95
MLDEFTLGIVAIAAGVLILIGWVPQIIQGYKTKKLEDVSKYLVIAIFSGAALWLVYGIEI
DDVYIIGVNVAAMFLTMTVLIMKLKYEKAFESIRK
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 8 Model end: 85 Inward Open: Template: 4X5M.pdb Model structure: A0A0A7V317_inward.pdb Alignment file: A0A0A7V317_inw.pir Procheck score ⇒ Ramachandran plot: 91.9% favored 5.9% allowed 2.2% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0A7V317_outward.pdb Alignment file: A0A0A7V317_out.pir Procheck score ⇒ Ramachandran plot: 94.9% favored 5.1% allowed .0% week .0% disallowed Occluded: Model structure: A0A0A7V317_occluded.pdb Alignment file: A0A0A7V317_occ.pir Procheck score ⇒ Ramachandran plot: 95.6% favored 4.4% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA