Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0A7V317

dbSWEET id: dbswt_2046

Accession:   A0A0A7V317

Uniprot status:   Unreviewed

Organism:   Candidatus Nitrosopelagicus

Kingdom:   Archaea

Taxonomy back to top


Archaea ⇒ Thaumarchaeota ⇒ unclassified Thaumarchaeota.

Sequence Information back to top


Sequence length:   95

Substrate Binding Site:   ANAN           CVV:   326       CHI:   -3.4

Selectivity Filter:   GGGG           CVV:   192       CHI:   -1.6

Fasta sequence:

>tr|A0A0A7V317|A0A0A7V317_9ARCH|Unreviewed|Candidatus Nitrosopelagicus|95
MLDEFTLGIVAIAAGVLILIGWVPQIIQGYKTKKLEDVSKYLVIAIFSGAALWLVYGIEI
DDVYIIGVNVAAMFLTMTVLIMKLKYEKAFESIRK

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   8     Model end:   85

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0A7V317_inward.pdb    Alignment file: A0A0A7V317_inw.pir

Procheck score ⇒ Ramachandran plot: 91.9% favored    5.9% allowed    2.2% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0A7V317_outward.pdb    Alignment file: A0A0A7V317_out.pir

Procheck score ⇒ Ramachandran plot: 94.9% favored    5.1% allowed    .0% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0A7V317_occluded.pdb    Alignment file: A0A0A7V317_occ.pir

Procheck score ⇒ Ramachandran plot: 95.6% favored    4.4% allowed    .0% week    .0% disallowed

Gene Informationback to top


Gene ID:   24816530

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur