Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0A6ZDW5

dbSWEET id: dbswt_267

Accession:   A0A0A6ZDW5

Uniprot status:   Unreviewed

Organism:   Nicotiana attenuata

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Solanales ⇒ Solanaceae ⇒ Nicotianoideae ⇒ Nicotianeae ⇒ Nicotiana.

Sequence Information back to top


Sequence length:   272

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   VSVC           CVV:   369       CHI:   10.1

Fasta sequence:

>tr|A0A0A6ZDW5|A0A0A6ZDW5_NICAT|Unreviewed|Nicotiana_attenuata|272
MTLLSVQELAFLFGLLGNIVSFMVFLAPVPTFYKIYKKGSSEGFQAIPYVVALFSAGLLL
YYAYLTKNAFLIVTINAFGCVIELTYIFLFLFYASKKSKMTTVWLMLLDVGALGIVMLFS
YLFAKGTKRVEIVGWICAIVNIAVFAAPLSIMRQVIKTKSVEFMPFTLSLFLTLCATMWF
FYGYFKKDYYIALPNVLGFLLGIVQMILYIVYKYARRKYNGEWELEGIDINIKTDGNFEN
KIVSSMEKPSLENGHQSNQEHNRDMTSVLTLK

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   3     Model end:   214

Alignment file: A0A0A6ZDW5.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0A6ZDW5_inward.pdb

Procheck score ⇒ Ramachandran plot: 93.7% favored    5.3% allowed    .0% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0A6ZDW5_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.2% favored    5.8% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0A6ZDW5_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.6% favored    5.8% allowed    1.1% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF22

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur