Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0A2SR70

dbSWEET id: dbswt_1340

Accession:   A0A0A2SR70

Uniprot status:   Unreviewed

Organism:   Legionella norrlandica

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Gammaproteobacteria ⇒ Legionellales ⇒ Legionellaceae ⇒ Legionella.

Sequence Information back to top


Sequence length:   88

Substrate Binding Site:   SNSN           CVV:   338       CHI:   -8.6

Selectivity Filter:   GCGC           CVV:   268       CHI:   4.2

Fasta sequence:

>tr|A0A0A2SR70|A0A0A2SR70_9GAMM|Unreviewed|Legionella norrlandica|88
MSIVMLSGMVAFTTSFIGLLPQIVKSLKTQSTQDLSMMMLINYFICSLAWIIYGSNTNSF
FVISSNVVGLVVSILLILLKRYYDSRCE

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   82

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0A2SR70_inward.pdb    Alignment file: A0A0A2SR70_inw.pir

Procheck score ⇒ Ramachandran plot: 95.0% favored    3.6% allowed    1.4% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0A2SR70_outward.pdb    Alignment file: A0A0A2SR70_out.pir

Procheck score ⇒ Ramachandran plot: 92.9% favored    5.7% allowed    1.4% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0A2SR70_occluded.pdb    Alignment file: A0A0A2SR70_occ.pir

Procheck score ⇒ Ramachandran plot: 95.0% favored    5.0% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur