Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0A2M8G0

dbSWEET id: dbswt_1339

Accession:   A0A0A2M8G0

Uniprot status:   Unreviewed

Organism:   Flavobacterium rivuli

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Bacteroidetes ⇒ Flavobacteriia ⇒ Flavobacteriales ⇒ Flavobacteriaceae ⇒ Flavobacterium.

Sequence Information back to top


Sequence length:   90

Substrate Binding Site:   NNNN           CVV:   384       CHI:   -14

Selectivity Filter:   SGSG           CVV:   242       CHI:   -2.4

Fasta sequence:

>tr|A0A0A2M8G0|A0A0A2M8G0_9FLAO|Unreviewed|Flavobacterium rivuli|90
MDFIELVGIVAGLCTSSSIIPQLVKTIKSKKAGDVSVLMFIVLLTGNSLWVYYGADKGDV
PIIATNILSILLNVAMLICKFKYKKNDDDH

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   82

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0A2M8G0_inward.pdb    Alignment file: A0A0A2M8G0_inw.pir

Procheck score ⇒ Ramachandran plot: 95.5% favored    3.7% allowed    .7% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0A2M8G0_outward.pdb    Alignment file: A0A0A2M8G0_out.pir

Procheck score ⇒ Ramachandran plot: 94.8% favored    4.5% allowed    .0% week    .7% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0A2M8G0_occluded.pdb    Alignment file: A0A0A2M8G0_occ.pir

Procheck score ⇒ Ramachandran plot: 97.8% favored    2.2% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur