Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0A2C0C8

dbSWEET id: dbswt_1338

Accession:   A0A0A2C0C8

Uniprot status:   Unreviewed

Organism:   Prochlorococcus

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Cyanobacteria ⇒ Synechococcales ⇒ Prochloraceae ⇒ Prochlorococcus.

Sequence Information back to top


Sequence length:   96

Substrate Binding Site:   ININ           CVV:   440       CHI:   2

Selectivity Filter:   AGAG           CVV:   230       CHI:   2.8

Fasta sequence:

>tr|A0A0A2C0C8|A0A0A2C0C8_9PROC|Unreviewed|Prochlorococcus|96
MNIDSIDLLGLVAGTLTTVAFVPQLLKVWNSKSAKDISYVMFIMFIFGIVLWEVYGWEIH
SFPVILFNVITFVLGLAILVLKFIFDKNETPEKSNL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   7     Model end:   84

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0A2C0C8_inward.pdb    Alignment file: A0A0A2C0C8_inw.pir

Procheck score ⇒ Ramachandran plot: 94.1% favored    5.1% allowed    .7% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0A2C0C8_outward.pdb    Alignment file: A0A0A2C0C8_out.pir

Procheck score ⇒ Ramachandran plot: 95.6% favored    3.7% allowed    .7% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0A2C0C8_occluded.pdb    Alignment file: A0A0A2C0C8_occ.pir

Procheck score ⇒ Ramachandran plot: 97.1% favored    2.9% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur