Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0A1XRW5

dbSWEET id: dbswt_1015

Accession:   A0A0A1XRW5

Uniprot status:   Unreviewed

Organism:   Bactrocera cucurbitae

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Diptera ⇒ Brachycera ⇒ Muscomorpha ⇒ Tephritoidea ⇒ Tephritidae ⇒ Bactrocera ⇒ Zeugodacus.

Sequence Information back to top


Sequence length:   225

Substrate Binding Site:   TNWN           CVV:   448       CHI:   -8.6

Selectivity Filter:   QSFV           CVV:   427       CHI:   2.7

Fasta sequence:

>tr|A0A0A1XRW5|A0A0A1XRW5_BACCU|Unreviewed|Bactrocera_cucurbitae|225
MPLPTYDVLLESTAVVSTILQFLSGVIICRKYIQKKSTGESSGLPFICGFLSTSFWLRYG
MLTDERSVILVNIIGSFLFLCYTMVYYIFSVNKKSFMRQFGIVLFILFGVWYYTNLIEIE
AEKVRMMGLVCCIITVCFFAAPLTMLIHVIRVKNSESLPFPLIVMTFLVSVLWVIYGVII
SDTFIQIPNFLGCLLSMLQLCLFVVYPPKTYSGQGYRLVDQAPIF

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   208

Alignment file: A0A0A1XRW5.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0A1XRW5_inward.pdb

Procheck score ⇒ Ramachandran plot: 92.0% favored    6.4% allowed    .5% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0A1XRW5_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.4% favored    5.9% allowed    2.7% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0A1XRW5_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.4% favored    7.5% allowed    .5% week    .5% disallowed

Gene Informationback to top


Gene ID:   105221346     Total Exons:   5     Coding Exons:   5

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur