Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0A1PYF7

dbSWEET id: dbswt_1336

Accession:   A0A0A1PYF7

Uniprot status:   Unreviewed

Organism:   bacterium YEK0313

Kingdom:   Bacteria

Taxonomy back to top


Bacteria.

Sequence Information back to top


Sequence length:   87

Substrate Binding Site:   ININ           CVV:   440       CHI:   2

Selectivity Filter:   CGCG           CVV:   268       CHI:   4.2

Fasta sequence:

>tr|A0A0A1PYF7|A0A0A1PYF7_9BACT|Unreviewed|bacterium YEK0313|87
MFGPALIHLIGLTAAIVTTLCWIPQALQIIRTRDTRAISLPAYGAYSGGIMLWLVYGIML
GDLPLIFANTITLALQLVIVGLKLRYG

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   8     Model end:   85

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0A1PYF7_inward.pdb    Alignment file: A0A0A1PYF7_inw.pir

Procheck score ⇒ Ramachandran plot: 95.4% favored    3.8% allowed    .8% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0A1PYF7_outward.pdb    Alignment file: A0A0A1PYF7_out.pir

Procheck score ⇒ Ramachandran plot: 95.4% favored    3.8% allowed    .8% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0A1PYF7_occluded.pdb    Alignment file: A0A0A1PYF7_occ.pir

Procheck score ⇒ Ramachandran plot: 97.7% favored    2.3% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur