| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0A0WYD7
dbSWEET id: dbswt_1335
Accession: A0A0A0WYD7
Uniprot status: Unreviewed
Organism: Treponema
Kingdom: Bacteria
Sequence Information back to top
Sequence length: 85
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A0A0WYD7|A0A0A0WYD7_9SPIO|Unreviewed|Treponema|85
MSENKLKIIGWIGTALSVTMYISYIPQIMNNLSGNKTVFLQPLAAAVNCTIWVLYALLKD
KRDYPLAAANAPGIIFGLIATITAF
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 10 Model end: 86 Inward Open: Template: 4X5M.pdb Model structure: A0A0A0WYD7_inward.pdb Alignment file: A0A0A0WYD7_inw.pir Procheck score ⇒ Ramachandran plot: 90.9% favored 6.8% allowed 1.5% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0A0WYD7_outward.pdb Alignment file: A0A0A0WYD7_out.pir Procheck score ⇒ Ramachandran plot: 89.4% favored 9.8% allowed .0% week .8% disallowed Occluded: Model structure: A0A0A0WYD7_occluded.pdb Alignment file: A0A0A0WYD7_occ.pir Procheck score ⇒ Ramachandran plot: 90.9% favored 6.8% allowed 2.3% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA