Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0A0M1I0

dbSWEET id: dbswt_448

Accession:   A0A0A0M1I0

Uniprot status:   Unreviewed

Organism:   Cucumis sativus

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Cucurbitales ⇒ Cucurbitaceae ⇒ Benincaseae ⇒ Cucumis.

Sequence Information back to top


Sequence length:   295

Substrate Binding Site:   TNWN           CVV:   448       CHI:   -8.6

Selectivity Filter:   VSMN           CVV:   398       CHI:   1.8

Fasta sequence:

>tr|A0A0A0M1I0|A0A0A0M1I0_CUCSA|Unreviewed|Cucumis_sativus|295
MAASLSFVMGIIGNVISILVFASPMKTFIGIVKKKSTENYKGIPYVTTLLSTSLWTFYGI
LKPGGLLVATVNGVGVLFQLFYVTLFIVFAPKQKKVTTIKLVGLFNVLFYGSVIGATLLV
MHGPLRLTFVGIICAALTIGMYASPLAAMKNVIRTKSVEYMPFLLSFFLFLNAGIWSAYA
LLVKDIYIGVPNGIGFVLGLAQLILYGIYKNKSKSTKSTEMMEDEGSAQLVEMGMNGEDD
HQKNRSIIKGLSLPKPTLDRQYSVKNILRSLSYGPYDFHSTGPLDEYDEVENGKF

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   211

Alignment file: A0A0A0M1I0.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0A0M1I0_inward.pdb

Procheck score ⇒ Ramachandran plot: 95.5% favored    4.5% allowed    .0% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0A0M1I0_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.9% favored    5.0% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0A0M1I0_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.2% favored    6.1% allowed    1.7% week    .0% disallowed

Gene Informationback to top


Gene ID:   101203449     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur