| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0A0LR77
dbSWEET id: dbswt_904
Accession: A0A0A0LR77
Uniprot status: Unreviewed
Organism: Cucumis sativus
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Cucurbitales ⇒ Cucurbitaceae ⇒ Benincaseae ⇒ Cucumis.
Sequence Information back to top
Sequence length: 238
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LNMN CVV: 440 CHI: -1.3
Fasta sequence:
>tr|A0A0A0LR77|A0A0A0LR77_CUCSA|Unreviewed|Cucumis_sativus|238
MVNTETARTVIGIIGNVISFGLFMSPIPTFVKIIKHKAVEDFKPDPYLATILNCAMWVFY
GMPFVHPDSILVVTINGIGFFIEAVYVSIFFIYSPWAKKKKMMVILLIETIFFAVVVVIT
LLVFHTTTTRTYFVGILCIIFNIGMYTSPLTVMRLVIKTRSVKYMPFTLSLANFCNGIVW
AIYAILKFDPNVLIPNSLGALSGLIQLILYATYYKTTNWDSDDSSRSKRPEVQMTDNV
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 215
Alignment file: A0A0A0LR77.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0A0LR77_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.6% favored 6.3% allowed 1.1% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0A0LR77_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.6% favored 7.4% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0A0LR77_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.6% favored 6.3% allowed 2.1% week .0% disallowed
Gene Informationback to top
Gene ID: 101222361 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA