Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0A0LMX6
dbSWEET id: dbswt_262
Accession: A0A0A0LMX6
Uniprot status: Unreviewed
Organism: Cucumis sativus
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Cucurbitales ⇒ Cucurbitaceae ⇒ Benincaseae ⇒ Cucumis.
Sequence Information back to top
Sequence length: 262
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|A0A0A0LMX6|A0A0A0LMX6_CUCSA|Unreviewed|Cucumis_sativus|262
MNGLSVHQLQFIFGLLGNIISFLVFLAPMPTFWTIYKKKTSEGFQSIPYVVALMSAMLLL
YYAALKTNAYLLVSINSFGCVIEVIYIALYLFYAPKKQKIFTLKLFIIFNLGFSGVMVGG
TMFFLHGMKRTNAVGWICAAFNLSVFASPLSIMKRVITTKSVEYMPFSLSFFLTLSATMW
FFYGFFIKDLFIALPNVVGFLLGMVQMIMYMIYKDSKGKVEEKLEEGAKFCEEDDQTLSI
VKTQSETKEINMAETNHYKIHE
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 3 Model end: 215
Alignment file: A0A0A0LMX6.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0A0LMX6_inward.pdb
Procheck score ⇒ Ramachandran plot: 95.3% favored 2.6% allowed 1.6% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0A0LMX6_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.2% favored 4.7% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0A0LMX6_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.2% favored 5.3% allowed 1.1% week .5% disallowed
Gene Informationback to top
Gene ID: 101218764 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF22