| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0A0KNA4
dbSWEET id: dbswt_584
Accession: A0A0A0KNA4
Uniprot status: Unreviewed
Organism: Cucumis sativus
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Cucurbitales ⇒ Cucurbitaceae ⇒ Benincaseae ⇒ Cucumis.
Sequence Information back to top
Sequence length: 259
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LNMA CVV: 411 CHI: 4
Fasta sequence:
>tr|A0A0A0KNA4|A0A0A0KNA4_CUCSA|Unreviewed|Cucumis_sativus|259
MRSLYTIRMAVGIIGNGASLLLYTVPILTFWRVIKKKSTEEFSCVPYIVALMNCLLYTWY
GLPIVSKGWENFPVVTINGLGILLELSFISIYFCFASSQAKKKVVLKMVGVVTVFLCVGM
ISSFVLKTHHLRKFFVGCIGLVASIAMYASPLVAMKQVIKTKSVEFMPFYLSFFSFSASS
LWLAYGLLSHDLFLASPNLVGSPLGLLQLVLYCIYRNKEHEQGVLKKEKGGVIMEIQPNW
DLEKNNNENHIPHQNNSKI
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 217
Alignment file: A0A0A0KNA4.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0A0KNA4_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.8% favored 4.2% allowed 1.6% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0A0KNA4_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.8% favored 3.6% allowed 1.0% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0A0KNA4_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.1% favored 6.2% allowed 1.0% week 1.6% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA