Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0A0CEM0

dbSWEET id: dbswt_1333

Accession:   A0A0A0CEM0

Uniprot status:   Unreviewed

Organism:   Actinotalea fermentans

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Actinobacteria ⇒ Micrococcales ⇒ Cellulomonadaceae ⇒ Actinotalea.

Sequence Information back to top


Sequence length:   102

Substrate Binding Site:   FNFN           CVV:   462       CHI:   -1.4

Selectivity Filter:   SGSG           CVV:   242       CHI:   -2.4

Fasta sequence:

>tr|A0A0A0CEM0|A0A0A0CEM0_9CELL|Unreviewed|Actinotalea fermentans| 102
MNVSDVLAVVAASWGVAMAVSPVLQIRRMLQTRSAEDVSLGYFGILLPGFALWIAYGLSR
GDLALVVPNSVALVVTLTTVGIALRLRREAAADVERLAGSDA

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   8     Model end:   85

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0A0CEM0_inward.pdb    Alignment file: A0A0A0CEM0_inw.pir

Procheck score ⇒ Ramachandran plot: 92.3% favored    7.7% allowed    .0% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0A0CEM0_outward.pdb    Alignment file: A0A0A0CEM0_out.pir

Procheck score ⇒ Ramachandran plot: 94.6% favored    5.4% allowed    .0% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0A0CEM0_occluded.pdb    Alignment file: A0A0A0CEM0_occ.pir

Procheck score ⇒ Ramachandran plot: 93.8% favored    5.4% allowed    .0% week    .8% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur