Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A099G0W8
dbSWEET id: dbswt_1331
Accession: A0A099G0W8
Uniprot status: Unreviewed
Organism: Paracoccus sanguinis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Alphaproteobacteria ⇒ Rhodobacterales ⇒ Rhodobacteraceae ⇒ Paracoccus.
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: VNVN CVV: 402 CHI: 1.4
Selectivity Filter: CTCT CVV: 358 CHI: 3.6
Fasta sequence:
>tr|A0A099G0W8|A0A099G0W8_9RHOB|Unreviewed|Paracoccus sanguinis|86
MSATELVGFAAAILGTVCWLPQVVKTWRSRAVDDLSWATNLLLFATVTMWLSYGLIKRDA
PLILSNIVAVLSIGAILVAKLRWGRR
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 5 Model end: 82 Inward Open: Template: 4X5M.pdb Model structure: A0A099G0W8_inward.pdb Alignment file: A0A099G0W8_inw.pir Procheck score ⇒ Ramachandran plot: 94.9% favored 2.9% allowed 1.4% week .7% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A099G0W8_outward.pdb Alignment file: A0A099G0W8_out.pir Procheck score ⇒ Ramachandran plot: 92.0% favored 6.5% allowed .7% week .7% disallowed Occluded: Model structure: A0A099G0W8_occluded.pdb Alignment file: A0A099G0W8_occ.pir Procheck score ⇒ Ramachandran plot: 94.9% favored 5.1% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA