Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A097SS59

dbSWEET id: dbswt_1330

Accession:   A0A097SS59

Uniprot status:   Unreviewed

Organism:   Candidatus Mycoplasma

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Tenericutes ⇒ Mollicutes ⇒ Mycoplasmataceae ⇒ Mycoplasma.

Sequence Information back to top


Sequence length:   153

Substrate Binding Site:   GNGN           CVV:   288       CHI:   -7.8

Selectivity Filter:   CVCV           CVV:   382       CHI:   13.4

Fasta sequence:

>tr|A0A097SS59|A0A097SS59_9MOLU|Unreviewed|Candidatus Mycoplasma| 153
MNTELLQAAALTEATPKMILNYIAIGAGIIGTLIAAFCFFPGIVKVIKTKDTRSMSYSMF
LWHVIGCVVWILVGACNFTTGIIARDYWQAFASGAATIAANISVILCDTVFLIYKYRNTH
KAKLLKMSENEYYEKYVFPKLIKENKKKKPLSN

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   25     Model end:   117

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A097SS59_inward.pdb    Alignment file: A0A097SS59_inw.pir

Procheck score ⇒ Ramachandran plot: 80.9% favored    13.6% allowed    3.7% week    1.9% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A097SS59_outward.pdb    Alignment file: A0A097SS59_out.pir

Procheck score ⇒ Ramachandran plot: 80.9% favored    14.2% allowed    3.1% week    1.9% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A097SS59_occluded.pdb    Alignment file: A0A097SS59_occ.pir

Procheck score ⇒ Ramachandran plot: 82.7% favored    12.3% allowed    3.7% week    1.2% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur