Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A096TFV6

dbSWEET id: dbswt_74

Accession:   A0A096TFV6

Uniprot status:   Unreviewed

Organism:   Zea mays

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ PACMAD clade ⇒ Panicoideae ⇒ Andropogonodae ⇒ Andropogoneae ⇒ Tripsacinae ⇒ Zea.

Sequence Information back to top


Sequence length:   310

Substrate Binding Site:   SNWN           CVV:   428       CHI:   -8.7

Selectivity Filter:   VSVS           CVV:   356       CHI:   6.8

Fasta sequence:

>tr|A0A096TFV6|A0A096TFV6_MAIZE|Unreviewed|Zea_mays|310
MAGGFFSMAHPAVTLSGIAGNIISFLVFLAPVATFLQVYRKKSTGGFSSVPYVVALFSSV
LWIFYALVKTNSRPLLTINAFGCGVEAAYIVLYLAYAPRRARLRTLAYFFLLDVAAFALV
VAVTLFAVREPHRVKFLGSVCLAFSMAVFVAPLSIIVKVVKTKSVEFLPISLSFCLTLSA
VAWFCYGLFTKDPFVMYPNVGGFFFSCVQMGLYFWYRKPRPAAKNNAVLPTTTDGANAVQ
VQGQVIELAPNTVAILSVSPIPIVGVHKIEVVEQQHKEAAVAAETRRMAAANPDGAMPEV
IEIVPAAAAV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   6     Model end:   218

Alignment file: A0A096TFV6.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A096TFV6_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.2% favored    3.7% allowed    1.1% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A096TFV6_outward.pdb

Procheck score ⇒ Ramachandran plot: 95.2% favored    4.2% allowed    .5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A096TFV6_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.7% favored    5.8% allowed    .0% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0005887 - integral component of plasma membrane

GO:0008515 - sucrose transmembrane transporter activity

GO:0006825 - copper ion transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur