Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A096SKI8

dbSWEET id: dbswt_685

Accession:   A0A096SKI8

Uniprot status:   Unreviewed

Organism:   Zea mays

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ PACMAD clade ⇒ Panicoideae ⇒ Andropogonodae ⇒ Andropogoneae ⇒ Tripsacinae ⇒ Zea.

Sequence Information back to top


Sequence length:   250

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   LNMC           CVV:   430       CHI:   4.7

Fasta sequence:

>tr|A0A096SKI8|A0A096SKI8_MAIZE|Unreviewed|Zea_mays|250
MEDVVKFVFGVSGNVIALFLFLSPVPTFWRIIRRKSTEDFSGVPYSMTLLNCLLSAWYGL
PFVSPNNMLVSTINGAGAAIEAVYVVIFLAFASSQRTRLRMLGLASAVSAAFAAVALASM
LALHGQGRKLMCGLAATVCSICMYASPLSIMRLVVKTKSVEYMPFLLSLAVFLCGTSWFV
YGLLGRDPFVAIPNGCGSFLGAVQLVLYAIYRDSNSGGKQQAGDDVEMASDAKSSKKVAD
DVGGKEDRLV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   213

Alignment file: A0A096SKI8.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A096SKI8_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.1% favored    4.3% allowed    .5% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A096SKI8_outward.pdb

Procheck score ⇒ Ramachandran plot: 95.1% favored    3.8% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A096SKI8_occluded.pdb

Procheck score ⇒ Ramachandran plot: 94.6% favored    4.9% allowed    .5% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0005783 - endoplasmic reticulum

GO:0005887 - integral component of plasma membrane

GO:0051119 - sugar transmembrane transporter activity

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur