Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A096MT12
dbSWEET id: dbswt_1014
Accession: A0A096MT12
Uniprot status: Unreviewed
Organism: Papio anubis
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Chordata ⇒ Craniata ⇒ Vertebrata ⇒ Euteleostomi ⇒ Mammalia ⇒ Eutheria ⇒ Euarchontoglires ⇒ Primates ⇒ Haplorrhini ⇒ Catarrhini ⇒ Cercopithecidae ⇒ Cercopithecinae ⇒ Papio.
Sequence Information back to top
Sequence length: 221
Substrate Binding Site: NNWN CVV: 451 CHI: -11.4
Selectivity Filter: MNMT CVV: 437 CHI: -0.4
Fasta sequence:
>tr|A0A096MT12|A0A096MT12_PAPAN|Unreviewed|Papio_anubis|221
MEAGGFLDSLIYGACVVFTLGMFSAGLSDLRHMRMTRSVDNVQFLPFLTTEVNNLGWLSY
GALKGDRILIVVNTVGAALQTLYILAYLHYCPRKRVVLLQTATLLGVLLLGYGYFWLLVP
NPEARLQQLGLFCSVFTISMYLSPLADLAKVIQTKSTQCLSYPLTIATVLTSASWCLYGF
RLRDPYIMVSNFPGIVTSFIRFWLFWKYPQEQDRNYWFLQT
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 210
Alignment file: A0A096MT12.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A096MT12_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.5% favored 3.8% allowed 2.2% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A096MT12_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.3% favored 7.1% allowed 1.6% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A096MT12_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.4% favored 7.1% allowed .5% week .0% disallowed
Gene Ontologyback to top
GO:0005794 - Golgi apparatus
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0042947 - glucoside transmembrane transporter activity
GO:0008643 - carbohydrate transport
GO:0045815 - positive regulation of gene expression epigenetic
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA