Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A096AJC2
dbSWEET id: dbswt_1329
Accession: A0A096AJC2
Uniprot status: Unreviewed
Organism: Peptoniphilus lacrimalis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Tissierellia ⇒ Tissierellales ⇒ Peptoniphilaceae ⇒ Peptoniphilus.
Sequence Information back to top
Sequence length: 87
Substrate Binding Site: CPCP CVV: 352 CHI: 1.8
Selectivity Filter: ASAS CVV: 280 CHI: 2
Fasta sequence:
>tr|A0A096AJC2|A0A096AJC2_9FIRM|Unreviewed|Peptoniphilus lacrimalis|87
MTKQRINQVVGSIGAFIGIIVFIAYIPQIFANLQGNKAQPFQPLSAAVSCLIWVIYGWTK
EPKKDWILIIPNSAGVILGGLTFLTAL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 11 Model end: 87 Inward Open: Template: 4X5M.pdb Model structure: A0A096AJC2_inward.pdb Alignment file: A0A096AJC2_inw.pir Procheck score ⇒ Ramachandran plot: 87.9% favored 11.3% allowed .8% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A096AJC2_outward.pdb Alignment file: A0A096AJC2_out.pir Procheck score ⇒ Ramachandran plot: 90.3% favored 5.6% allowed 3.2% week .8% disallowed Occluded: Model structure: A0A096AJC2_occluded.pdb Alignment file: A0A096AJC2_occ.pir Procheck score ⇒ Ramachandran plot: 85.5% favored 13.7% allowed .8% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA