| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A095WLJ4
dbSWEET id: dbswt_1326
Accession: A0A095WLJ4
Uniprot status: Unreviewed
Organism: Fusobacterium periodonticum
Kingdom: Bacteria
Sequence Information back to top
Sequence length: 87
Substrate Binding Site: CPCP CVV: 352 CHI: 1.8
Selectivity Filter: SSSS CVV: 292 CHI: -3.2
Fasta sequence:
>tr|A0A095WLJ4|A0A095WLJ4_9FUSO|Unreviewed|Fusobacterium periodonticum|87
MSKAKFNAIVGSIGAFIGIFVFISYIPQIIANLNGAKSQPLQPLFAAVSCLIWVIYGWTK
EPKKDYILIAPNLAGVILGTITFLTAL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 11 Model end: 87 Inward Open: Template: 4X5M.pdb Model structure: A0A095WLJ4_inward.pdb Alignment file: A0A095WLJ4_inw.pir Procheck score ⇒ Ramachandran plot: 89.7% favored 7.9% allowed 2.4% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A095WLJ4_outward.pdb Alignment file: A0A095WLJ4_out.pir Procheck score ⇒ Ramachandran plot: 90.5% favored 7.9% allowed 1.6% week .0% disallowed Occluded: Model structure: A0A095WLJ4_occluded.pdb Alignment file: A0A095WLJ4_occ.pir Procheck score ⇒ Ramachandran plot: 89.7% favored 8.7% allowed .8% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA