| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A090MH70
dbSWEET id: dbswt_1323
Accession: A0A090MH70
Uniprot status: Unreviewed
Organism: Afipia felis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Alphaproteobacteria ⇒ Rhizobiales ⇒ Bradyrhizobiaceae ⇒ Afipia.
Sequence Information back to top
Sequence length: 92
Substrate Binding Site: LNLN CVV: 440 CHI: 0.6
Selectivity Filter: SGSG CVV: 242 CHI: -2.4
Fasta sequence:
>tr|A0A090MH70|A0A090MH70_AFIFE|Unreviewed|Afipia felis|92
MNGSLTIGALGLAAAALTSLSYLPQARKALPRGATKDLSLKTLGALLVGLCLWAVYGILR
SDVVIVIANSVGAVLVAIVLVCKLRDLLYCRR
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 8 Model end: 85 Inward Open: Template: 4X5M.pdb Model structure: A0A090MH70_inward.pdb Alignment file: A0A090MH70_inw.pir Procheck score ⇒ Ramachandran plot: 94.8% favored 3.7% allowed 1.5% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A090MH70_outward.pdb Alignment file: A0A090MH70_out.pir Procheck score ⇒ Ramachandran plot: 92.5% favored 6.7% allowed .7% week .0% disallowed Occluded: Model structure: A0A090MH70_occluded.pdb Alignment file: A0A090MH70_occ.pir Procheck score ⇒ Ramachandran plot: 96.3% favored 3.7% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA