Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A090MH70

dbSWEET id: dbswt_1323

Accession:   A0A090MH70

Uniprot status:   Unreviewed

Organism:   Afipia felis

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Alphaproteobacteria ⇒ Rhizobiales ⇒ Bradyrhizobiaceae ⇒ Afipia.

Sequence Information back to top


Sequence length:   92

Substrate Binding Site:   LNLN           CVV:   440       CHI:   0.6

Selectivity Filter:   SGSG           CVV:   242       CHI:   -2.4

Fasta sequence:

>tr|A0A090MH70|A0A090MH70_AFIFE|Unreviewed|Afipia felis|92
MNGSLTIGALGLAAAALTSLSYLPQARKALPRGATKDLSLKTLGALLVGLCLWAVYGILR
SDVVIVIANSVGAVLVAIVLVCKLRDLLYCRR

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   8     Model end:   85

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A090MH70_inward.pdb    Alignment file: A0A090MH70_inw.pir

Procheck score ⇒ Ramachandran plot: 94.8% favored    3.7% allowed    1.5% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A090MH70_outward.pdb    Alignment file: A0A090MH70_out.pir

Procheck score ⇒ Ramachandran plot: 92.5% favored    6.7% allowed    .7% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A090MH70_occluded.pdb    Alignment file: A0A090MH70_occ.pir

Procheck score ⇒ Ramachandran plot: 96.3% favored    3.7% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur