Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A090KPN9

dbSWEET id: dbswt_1012

Accession:   A0A090KPN9

Uniprot status:   Unreviewed

Organism:   Strongyloides ratti

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Panagrolaimoidea ⇒ Strongyloididae ⇒ Strongyloides.

Sequence Information back to top


Sequence length:   230

Substrate Binding Site:   NLFQ           CVV:   469       CHI:   -0.4

Selectivity Filter:   LIRI           CVV:   520       CHI:   8.3

Fasta sequence:

>tr|A0A090KPN9|A0A090KPN9_STRRB|Unreviewed|Strongyloides_ratti|230
MNLTDIFGIYVGLLGISLCFLPLITIKEWYKKKSSDGFPSIGYITSTYINAVWLKYGLMS
QIDNQNTFLVIMLILNGIYTLIYLFYSSNKVTFIGKNIVMLICTYLVLHYTDSLIFEEGT
VFIGRMASFSNSLRFVPAIADVYNVFKIKTTEYIPFQQTCAFAFILSQFFIHSFMTGNYY
KMYTQIVGLATIGLYFTLYYIYPPKTWEVPIFRKKSTKNDNEIKIKKKKN

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   204

Alignment file: A0A090KPN9.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A090KPN9_inward.pdb

Procheck score ⇒ Ramachandran plot: 89.7% favored    7.6% allowed    1.1% week    1.6% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A090KPN9_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.3% favored    8.2% allowed    .5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A090KPN9_occluded.pdb

Procheck score ⇒ Ramachandran plot: 90.2% favored    8.7% allowed    .0% week    1.1% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur