| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A088REF9
dbSWEET id: dbswt_1322
Accession: A0A088REF9
Uniprot status: Unreviewed
Organism: Treponema putidum
Kingdom: Bacteria
Sequence Information back to top
Sequence length: 87
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A088REF9|A0A088REF9_9SPIO|Unreviewed|Treponema putidum|87
MMNSKFFTILGWVATATAMAMYVSYIPQISNNLNGMKGNWLQPLVAAINCTLWVTYGLMK
KPKRDWPIAFANSPGIVFGLVAFITAL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 11 Model end: 88 Inward Open: Template: 4X5M.pdb Model structure: A0A088REF9_inward.pdb Alignment file: A0A088REF9_inw.pir Procheck score ⇒ Ramachandran plot: 93.8% favored 3.8% allowed 1.5% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A088REF9_outward.pdb Alignment file: A0A088REF9_out.pir Procheck score ⇒ Ramachandran plot: 90.0% favored 6.9% allowed .8% week 2.3% disallowed Occluded: Model structure: A0A088REF9_occluded.pdb Alignment file: A0A088REF9_occ.pir Procheck score ⇒ Ramachandran plot: 94.6% favored 5.4% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA