Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A087ZRA4

dbSWEET id: dbswt_1010

Accession:   A0A087ZRA4

Uniprot status:   Unreviewed

Organism:   Apis mellifera

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Hymenoptera ⇒ Apocrita ⇒ Aculeata ⇒ Apoidea ⇒ Apidae ⇒ Apis.

Sequence Information back to top


Sequence length:   220

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   QMLV           CVV:   467       CHI:   6.4

Fasta sequence:

>tr|A0A087ZRA4|A0A087ZRA4_APIME|Unreviewed|Apis_mellifera|220
MGLEDYKELVASCASICTMGQMLSGTLICKDIYQKGSSEGFDSMPFLGGVGMCILMLQYA
WILKDIAMINVNVFGLLTNMAYMAVFYYYSPHTKDILALIGKATTFVMVFLAYAQVESPE
KIEFRFGLIVTVLLLLLVAFPLVHLRKIIETKNTDILPFPIIFMGTIVTFLWLLYGLIIN
NVFIIFQNSVAFVLSLAQLSLFVIYPSKSKNKESTQKKAE

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   207

Alignment file: A0A087ZRA4.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A087ZRA4_inward.pdb

Procheck score ⇒ Ramachandran plot: 90.3% favored    7.0% allowed    1.6% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A087ZRA4_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.0% favored    5.4% allowed    1.1% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A087ZRA4_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.4% favored    6.5% allowed    .5% week    1.6% disallowed

Gene Informationback to top


Gene ID:   409141     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF5

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur