Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A087UQQ6

dbSWEET id: dbswt_1008

Accession:   A0A087UQQ6

Uniprot status:   Unreviewed

Organism:   Stegodyphus mimosarum

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Chelicerata ⇒ Arachnida ⇒ Araneae ⇒ Araneomorphae ⇒ Entelegynae ⇒ Eresoidea ⇒ Eresidae ⇒ Stegodyphus.

Sequence Information back to top


Sequence length:   213

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   SSTV           CVV:   344       CHI:   1.9

Fasta sequence:

>tr|A0A087UQQ6|A0A087UQQ6_9ARAC|Unreviewed|Stegodyphus_mimosarum|213
MDLILIVGNVALICTIASNFAGLPLCFEYAKKKTTSNASVLPFLAGVTSCSLWFQYGVVT
GDFTLELVNIISTFLQFCYVTCFYIYTPYKPHTKKLITAASIFLFFTYVYCFQLTENHST
AVQILGIFGCISSILTCAAPLASIGQVLKTKSTESLPFPIILATFIVAALWLFYGFLKQD
TFLQIPNAIGAMLSGFQLSLFVIFPGNPSKTGL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   206

Alignment file: A0A087UQQ6.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A087UQQ6_inward.pdb

Procheck score ⇒ Summary not found

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A087UQQ6_outward.pdb

Procheck score ⇒ Summary not found

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A087UQQ6_occluded.pdb

Procheck score ⇒ Summary not found

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur