Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A087SZL1

dbSWEET id: dbswt_1007

Accession:   A0A087SZL1

Uniprot status:   Unreviewed

Organism:   Stegodyphus mimosarum

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Chelicerata ⇒ Arachnida ⇒ Araneae ⇒ Araneomorphae ⇒ Entelegynae ⇒ Eresoidea ⇒ Eresidae ⇒ Stegodyphus.

Sequence Information back to top


Sequence length:   216

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   VSFM           CVV:   437       CHI:   8.1

Fasta sequence:

>tr|A0A087SZL1|A0A087SZL1_9ARAC|Unreviewed|Stegodyphus_mimosarum|216
MDLKNIVGQAATVCTIAVFLAGIEICRKIWKKKSTSDISALPFLCGLVSCSLWLRYGLLV
NDSALIVVNTTGGILQILYIMWYARFTVSKGIFYKQLALSLSVIGFLYCLTTFSFEGELS
QQISGIAACSAGVIFMASPLATVAHVLRTKTVETLPFAMILSTFAMATLWLCYGILINDK
FVQVPNFLGALLSLSQLCLFAVFPNKKPYYELGSIS

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   205

Alignment file: A0A087SZL1.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A087SZL1_inward.pdb

Procheck score ⇒ Ramachandran plot: 93.0% favored    5.9% allowed    .5% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A087SZL1_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.5% favored    5.4% allowed    .5% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A087SZL1_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.0% favored    5.4% allowed    1.6% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur