| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A087H3U5
dbSWEET id: dbswt_247
Accession: A0A087H3U5
Uniprot status: Unreviewed
Organism: Arabis alpina
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Arabideae ⇒ Arabis.
Sequence Information back to top
Sequence length: 267
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSVN CVV: 379 CHI: 4.1
Fasta sequence:
>tr|A0A087H3U5|A0A087H3U5_ARAAL|Unreviewed|Arabis_alpina|267
MVSLKVHEIAFLFGLMGNIVSFGVFLSPVPTFYGIYKKKTSKGFQSIPYICALASATLLL
YYGIMKTHAYLIISINTFGCFIEISYLFLYVFYAPREAKIFTLKLIVICNIGGLGLLIIL
VNLLVPKQHRVSTVGWVCAAYSLAVFASPLSVMRKVIRTKSVEYMPFLLSLSLTLNAVMW
FFYGLLIKDKFIAMPNILGFMFGISQMILYMMYRNSNKTDLPNLTPTENQLTSKTEVPIV
AIELPDARSDNVGGSVRTTTIPNSNTA
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 3 Model end: 215
Alignment file: A0A087H3U5.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A087H3U5_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.1% favored 3.7% allowed 1.6% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A087H3U5_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.5% favored 7.4% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A087H3U5_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.1% favored 5.3% allowed 1.6% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA