Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A087GA05
dbSWEET id: dbswt_201
Accession: A0A087GA05
Uniprot status: Unreviewed
Organism: Arabis alpina
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Arabideae ⇒ Arabis.
Sequence Information back to top
Sequence length: 281
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|A0A087GA05|A0A087GA05_ARAAL|Unreviewed|Arabis_alpina|281
MAISPAVLVTVFGLLGDIISFFVCLAPIPTFVRIYKRKSSEGYQSIPYVIALFSAMLWIY
YALVRKHAVLLITINTFCCVIQIFYISFYLFYAPKKEKTLTVKFVLFVDVFAFGLIFLLT
YFLTHGIKRVQVLGYICMVFALCVFVAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAVMWF
FYGLLLKDMNVALPNVLGFIFGVLQMILYMIYKKPGTKVLEPSGIKLQDISEHVVDVVRL
SSMVCSSQMRALVPQDSADMEATIDIDEKIKGDFVKIKDDK
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 2 Model end: 214
Alignment file: A0A087GA05.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A087GA05_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.8% favored 3.7% allowed 1.0% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A087GA05_outward.pdb
Procheck score ⇒ Ramachandran plot: 95.3% favored 3.7% allowed 1.0% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A087GA05_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.2% favored 5.8% allowed .0% week 1.0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF22