Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A087GA05

dbSWEET id: dbswt_201

Accession:   A0A087GA05

Uniprot status:   Unreviewed

Organism:   Arabis alpina

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Arabideae ⇒ Arabis.

Sequence Information back to top


Sequence length:   281

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   VSVS           CVV:   356       CHI:   6.8

Fasta sequence:

>tr|A0A087GA05|A0A087GA05_ARAAL|Unreviewed|Arabis_alpina|281
MAISPAVLVTVFGLLGDIISFFVCLAPIPTFVRIYKRKSSEGYQSIPYVIALFSAMLWIY
YALVRKHAVLLITINTFCCVIQIFYISFYLFYAPKKEKTLTVKFVLFVDVFAFGLIFLLT
YFLTHGIKRVQVLGYICMVFALCVFVAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAVMWF
FYGLLLKDMNVALPNVLGFIFGVLQMILYMIYKKPGTKVLEPSGIKLQDISEHVVDVVRL
SSMVCSSQMRALVPQDSADMEATIDIDEKIKGDFVKIKDDK

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   2     Model end:   214

Alignment file: A0A087GA05.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A087GA05_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.8% favored    3.7% allowed    1.0% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A087GA05_outward.pdb

Procheck score ⇒ Ramachandran plot: 95.3% favored    3.7% allowed    1.0% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A087GA05_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.2% favored    5.8% allowed    .0% week    1.0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF22

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur