| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A087ENE1
dbSWEET id: dbswt_1321
Accession: A0A087ENE1
Uniprot status: Unreviewed
Organism: Lactobacillus kunkeei
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 104
Substrate Binding Site: ANAN CVV: 326 CHI: -3.4
Selectivity Filter: ANAN CVV: 326 CHI: -3.4
Fasta sequence:
>tr|A0A087ENE1|A0A087ENE1_9LACO|Unreviewed|Lactobacillus kunkeei| 104
MKIDNYVPKNQRREVSDKRIRNLKIMSKVAIFTSSLMYIAYIPEIMQNFSGNPVSPIQPF
VATVNATLWTLYGWFKTYKDWPLIISNVPGVIFGLITLVTVFIH
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 27 Model end: 103 Inward Open: Template: 4X5M.pdb Model structure: A0A087ENE1_inward.pdb Alignment file: A0A087ENE1_inw.pir Procheck score ⇒ Ramachandran plot: 87.5% favored 9.4% allowed 3.1% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A087ENE1_outward.pdb Alignment file: A0A087ENE1_out.pir Procheck score ⇒ Ramachandran plot: 88.3% favored 9.4% allowed 1.6% week .8% disallowed Occluded: Model structure: A0A087ENE1_occluded.pdb Alignment file: A0A087ENE1_occ.pir Procheck score ⇒ Ramachandran plot: 90.6% favored 7.8% allowed 1.6% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA