| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A086ATF6
dbSWEET id: dbswt_1318
Accession: A0A086ATF6
Uniprot status: Unreviewed
Organism: Chryseobacterium
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Bacteroidetes ⇒ Flavobacteriia ⇒ Flavobacteriales ⇒ Flavobacteriaceae ⇒ Chryseobacterium.
Sequence Information back to top
Sequence length: 84
Substrate Binding Site: LNLN CVV: 440 CHI: 0.6
Selectivity Filter: SGSG CVV: 242 CHI: -2.4
Fasta sequence:
>tr|A0A086ATF6|A0A086ATF6_9FLAO|Unreviewed|Chryseobacterium|84
MNENILGIVAGVLTSISMIPQLIKVIKEKNVDDISLVMLLVLISGLSLWVWYGFKKDELP
IILSNAFAVLVNISLLVSYMIYKK
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 4 Model end: 81 Inward Open: Template: 4X5M.pdb Model structure: A0A086ATF6_inward.pdb Alignment file: A0A086ATF6_inw.pir Procheck score ⇒ Ramachandran plot: 91.3% favored 7.2% allowed 1.4% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A086ATF6_outward.pdb Alignment file: A0A086ATF6_out.pir Procheck score ⇒ Ramachandran plot: 96.4% favored 3.6% allowed .0% week .0% disallowed Occluded: Model structure: A0A086ATF6_occluded.pdb Alignment file: A0A086ATF6_occ.pir Procheck score ⇒ Ramachandran plot: 92.0% favored 8.0% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA