Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A085B8Y9

dbSWEET id: dbswt_1314

Accession:   A0A085B8Y9

Uniprot status:   Unreviewed

Organism:   Epilithonimonas lactis

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Bacteroidetes ⇒ Flavobacteriia ⇒ Flavobacteriales ⇒ Flavobacteriaceae ⇒ Epilithonimonas.

Sequence Information back to top


Sequence length:   86

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|A0A085B8Y9|A0A085B8Y9_9FLAO|Unreviewed|Epilithonimonas lactis|86
MESKFMQVLGWVATVTAMAMYFSYIPQISHNLNGDKGDWLQPLVAGINCSLWVTYGFMKK
PKRDWPIVVANSPGIFFGLFAFATAI

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   10     Model end:   87

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A085B8Y9_inward.pdb    Alignment file: A0A085B8Y9_inw.pir

Procheck score ⇒ Ramachandran plot: 90.6% favored    7.8% allowed    .8% week    .8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A085B8Y9_outward.pdb    Alignment file: A0A085B8Y9_out.pir

Procheck score ⇒ Ramachandran plot: 96.1% favored    3.9% allowed    .0% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A085B8Y9_occluded.pdb    Alignment file: A0A085B8Y9_occ.pir

Procheck score ⇒ Ramachandran plot: 93.0% favored    3.1% allowed    1.6% week    2.3% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur