Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A084WT50

dbSWEET id: dbswt_1005

Accession:   A0A084WT50

Uniprot status:   Unreviewed

Organism:   Anopheles sinensis

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Diptera ⇒ Nematocera ⇒ Culicoidea ⇒ Culicidae ⇒ Anophelinae ⇒ Anopheles.

Sequence Information back to top


Sequence length:   224

Substrate Binding Site:   TNWN           CVV:   448       CHI:   -8.6

Selectivity Filter:   QLLV           CVV:   467       CHI:   8.3

Fasta sequence:

>tr|A0A084WT50|A0A084WT50_ANOSI|Unreviewed|Anopheles_sinensis|224
MEAISQALQPYKEQVGMAAGILTVGQMFSGCFVCNDIRKKGTTDGFSAMPFVGGCGLTVL
FLQHGLLMGDSAMTNANLVGLAISIVYTTFFLLYTPPTGRGSFWRQVGFTALFTLTILGY
AKIENPAVVEDRFGMIITVLMLCLIGQPLFGLPDIIRRKSTEGLPFAMILSGTIVGLSWL
LYGVILNNVFVVCQNLAAVSLSGIQLALFAIYPSKPAPPSKKRD

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   214

Alignment file: A0A084WT50.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A084WT50_inward.pdb

Procheck score ⇒ Ramachandran plot: 87.4% favored    10.3% allowed    .6% week    1.7% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A084WT50_outward.pdb

Procheck score ⇒ Ramachandran plot: 90.9% favored    8.0% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A084WT50_occluded.pdb

Procheck score ⇒ Ramachandran plot: 89.7% favored    8.6% allowed    1.7% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF5

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur