| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A084WT49
dbSWEET id: dbswt_1004
Accession: A0A084WT49
Uniprot status: Unreviewed
Organism: Anopheles sinensis
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Diptera ⇒ Nematocera ⇒ Culicoidea ⇒ Culicidae ⇒ Anophelinae ⇒ Anopheles.
Sequence Information back to top
Sequence length: 225
Substrate Binding Site: SSWK CVV: 444 CHI: -6.4
Selectivity Filter: QLFA CVV: 440 CHI: 4.9
Fasta sequence:
>tr|A0A084WT49|A0A084WT49_ANOSI|Unreviewed|Anopheles_sinensis|225
MAHEVLAALHPHRELIGQAAGLLTVSQYLAGWFICAEIRRRGTTTGFSPLRFVGGVGLSL
LQLQYSLKLQASALIWTSIATLLCSVFYSGWYFQFTPVEVRAPFYRLAVTTSTITVGILA
YGSQNDSPLVMFRLGLVLTVLALAFIALPLAQLGNVIREKSSASLPLPAILASTGASILW
LVYGLLIENSFIVVQKIIALGLCTAQLSLFIVYPAAGSVDKKKKQ
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 6 Model end: 215
Alignment file: A0A084WT49.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A084WT49_inward.pdb
Procheck score ⇒ Ramachandran plot: 91.3% favored 7.7% allowed .0% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A084WT49_outward.pdb
Procheck score ⇒ Ramachandran plot: 90.7% favored 7.7% allowed 1.1% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A084WT49_occluded.pdb
Procheck score ⇒ Ramachandran plot: 94.0% favored 4.4% allowed 1.6% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF5