Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A083WU83
dbSWEET id: dbswt_1313
Accession: A0A083WU83
Uniprot status: Unreviewed
Organism: Chryseobacterium antarcticum
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Bacteroidetes ⇒ Flavobacteriia ⇒ Flavobacteriales ⇒ Flavobacteriaceae ⇒ Chryseobacterium.
Sequence Information back to top
Sequence length: 88
Substrate Binding Site: LNLN CVV: 440 CHI: 0.6
Selectivity Filter: AGAG CVV: 230 CHI: 2.8
Fasta sequence:
>tr|A0A083WU83|A0A083WU83_9FLAO|Unreviewed|Chryseobacterium antarcticum|88
MNENILGLVAGGITSVAMLPQLIKVLKNKDVEDLSWLMIGTLIVGLSLWVWYGILKEELP
IILSNAFAVLVNICLLIAFFTYKKKNKK
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 4 Model end: 81 Inward Open: Template: 4X5M.pdb Model structure: A0A083WU83_inward.pdb Alignment file: A0A083WU83_inw.pir Procheck score ⇒ Ramachandran plot: 93.3% favored 4.5% allowed 2.2% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A083WU83_outward.pdb Alignment file: A0A083WU83_out.pir Procheck score ⇒ Ramachandran plot: 91.8% favored 7.5% allowed .0% week .7% disallowed Occluded: Model structure: A0A083WU83_occluded.pdb Alignment file: A0A083WU83_occ.pir Procheck score ⇒ Ramachandran plot: 94.0% favored 6.0% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA