Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A083WU83

dbSWEET id: dbswt_1313

Accession:   A0A083WU83

Uniprot status:   Unreviewed

Organism:   Chryseobacterium antarcticum

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Bacteroidetes ⇒ Flavobacteriia ⇒ Flavobacteriales ⇒ Flavobacteriaceae ⇒ Chryseobacterium.

Sequence Information back to top


Sequence length:   88

Substrate Binding Site:   LNLN           CVV:   440       CHI:   0.6

Selectivity Filter:   AGAG           CVV:   230       CHI:   2.8

Fasta sequence:

>tr|A0A083WU83|A0A083WU83_9FLAO|Unreviewed|Chryseobacterium antarcticum|88
MNENILGLVAGGITSVAMLPQLIKVLKNKDVEDLSWLMIGTLIVGLSLWVWYGILKEELP
IILSNAFAVLVNICLLIAFFTYKKKNKK

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   4     Model end:   81

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A083WU83_inward.pdb    Alignment file: A0A083WU83_inw.pir

Procheck score ⇒ Ramachandran plot: 93.3% favored    4.5% allowed    2.2% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A083WU83_outward.pdb    Alignment file: A0A083WU83_out.pir

Procheck score ⇒ Ramachandran plot: 91.8% favored    7.5% allowed    .0% week    .7% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A083WU83_occluded.pdb    Alignment file: A0A083WU83_occ.pir

Procheck score ⇒ Ramachandran plot: 94.0% favored    6.0% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur