| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A081QZB4
dbSWEET id: dbswt_1312
Accession: A0A081QZB4
Uniprot status: Unreviewed
Organism: Streptococcus mitis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Streptococcaceae ⇒ Streptococcus.
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A081QZB4|A0A081QZB4_STRMT|Unreviewed|Streptococcus mitis|86
MSEKQMKVLGWVAIFMSVMMYVSYFPQIMNNLAGQKGNFIQPLVAAINCSLWVYYGLFKK
ERDIPLAAANAPGIVFGLVTAITALI
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 10 Model end: 86 Inward Open: Template: 4X5M.pdb Model structure: A0A081QZB4_inward.pdb Alignment file: A0A081QZB4_inw.pir Procheck score ⇒ Ramachandran plot: 93.8% favored 5.4% allowed .8% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A081QZB4_outward.pdb Alignment file: A0A081QZB4_out.pir Procheck score ⇒ Ramachandran plot: 93.8% favored 6.2% allowed .0% week .0% disallowed Occluded: Model structure: A0A081QZB4_occluded.pdb Alignment file: A0A081QZB4_occ.pir Procheck score ⇒ Ramachandran plot: 90.8% favored 7.7% allowed .0% week 1.5% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA