| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A078E6B3
dbSWEET id: dbswt_568
Accession: A0A078E6B3
Uniprot status: Unreviewed
Organism: Brassica napus
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Brassiceae ⇒ Brassica.
Sequence Information back to top
Sequence length: 258
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LNMA CVV: 411 CHI: 4
Fasta sequence:
>tr|A0A078E6B3|A0A078E6B3_BRANA|Unreviewed|Brassica_napus|258
MGGKLRLFIGILGNGASMLLYTAPILTFSRVFKKKSTEEFSCFPYVMTLLNCLIYTWYGL
PIVSHLWENLPLVTINGVGILLESLFIFIYFCYSSPKEKVKVGVIFVPVVVILFGLAVIS
AVVFDEHRHRKSFVGSFGLVASISMYGSPLVVMKKVIETKSVEYMPFYLSFFSFLASSLW
LAYGLLSHDLFLASPNMVGTPLGILQLILYFKYKNKETPITTTVMSKWDDEKNKRTLELV
VDVDHDGDANEKKFNNAC
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 215
Alignment file: A0A078E6B3.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A078E6B3_inward.pdb
Procheck score ⇒ Ramachandran plot: 91.9% favored 5.9% allowed 1.6% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A078E6B3_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.9% favored 5.9% allowed 1.6% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A078E6B3_occluded.pdb
Procheck score ⇒ Ramachandran plot: 90.9% favored 8.6% allowed .5% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA