| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A078CGA5
dbSWEET id: dbswt_512
Accession: A0A078CGA5
Uniprot status: Unreviewed
Organism: Brassica napus
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Brassiceae ⇒ Brassica.
Sequence Information back to top
Sequence length: 231
Substrate Binding Site: SNWN CVV: 428 CHI: -8.7
Selectivity Filter: VGMN CVV: 373 CHI: 2.2
Fasta sequence:
>tr|A0A078CGA5|A0A078CGA5_BRANA|Unreviewed|Brassica_napus|231
MAELSFYVGVIGNVISVLVFLSPVETFWKIVKRRSTEEYECLPYICTLMGSLLWTYYGIV
TPGEYLVSTVNGFGVLAESIYVLIFLFFVPKPRILKTVALVLALNVIFPVIMIVGTRTAF
GYAKTRSNSMGFICAALNIIMYGSPLSAIKTVVKTRSVKYMPFWLSFLLFLNGAIWAVYA
LLLHDVFLLVPNGMGFFLGTVQLLIYTFYRNAKPNKEDEEEALAPSLPLLS
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 211
Alignment file: A0A078CGA5.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A078CGA5_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.9% favored 6.0% allowed .0% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A078CGA5_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.9% favored 6.0% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A078CGA5_occluded.pdb
Procheck score ⇒ Ramachandran plot: 94.6% favored 4.3% allowed 1.1% week .0% disallowed
Gene Informationback to top
Gene ID: 106356385 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA