| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A078C908
dbSWEET id: dbswt_241
Accession: A0A078C908
Uniprot status: Unreviewed
Organism: Brassica napus
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Brassiceae ⇒ Brassica.
Sequence Information back to top
Sequence length: 265
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSVN CVV: 379 CHI: 4.1
Fasta sequence:
>tr|A0A078C908|A0A078C908_BRANA|Unreviewed|Brassica_napus|265
MFYISLTIRHGNIVSFGVFLSPVPTFYGIYKKKSSKGFQSIPYICALASATLLLFYGIMK
THAYLIISINTFGCFIEISYLFLYIIYAPREARIFTLKLILICNIGGLGLLILLVDLLIP
KQHRVSTVGWVCAAYSLAVFASPLSVMRKVIRTKSVEYMPLLLSLSLTLNAVMWFFYGLL
IEDKFIAMPNILGFLFGIAQMILYMMYHDSKKTDLPKLISTENQPTNETNLNEVAIVAVE
LSDARAENVEGSVRPMKTPNSSTTA
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 209
Alignment file: A0A078C908.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A078C908_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.1% favored 4.9% allowed 1.1% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A078C908_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.4% favored 6.5% allowed .5% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A078C908_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.9% favored 7.0% allowed .5% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA