Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A078C3R1
dbSWEET id: dbswt_95
Accession: A0A078C3R1
Uniprot status: Unreviewed
Organism: Brassica napus
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Brassiceae ⇒ Brassica.
Sequence Information back to top
Sequence length: 298
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|A0A078C3R1|A0A078C3R1_BRANA|Unreviewed|Brassica_napus|298
MGVMINHHLLAIVFGILGNAISFLVFLAPVPTFYRIYKKKSTESFQSLPYQVSLFSCMLW
LCYALIKQDAFLLITINSFGCVVETIYIAMFFTYATKDKRIAAMKLFLTINVAFFSLILM
VTHFAVKRPSLQVSVLGWICVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISAV
MWFAYGLFLHDICIAIPNVVGFILGMVQMLLYGIYRNPGEKLDTEKKMNPSDQQLKSVVV
MSPLGVSEVHPIDDNMTEPVDPFSDAVQHKDPSKVTKEKEPATDDGKCHVETARHESV
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 4 Model end: 217
Alignment file: A0A078C3R1.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A078C3R1_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.9% favored 4.1% allowed 1.0% week 1.0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A078C3R1_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.9% favored 5.6% allowed 1.0% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A078C3R1_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.3% favored 6.6% allowed 1.0% week 1.0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA