| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A076L2F5
dbSWEET id: dbswt_893
Accession: A0A076L2F5
Uniprot status: Unreviewed
Organism: Nicotiana tabacum
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Solanales ⇒ Solanaceae ⇒ Nicotianoideae ⇒ Nicotianeae ⇒ Nicotiana.
Sequence Information back to top
Sequence length: 239
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LNMN CVV: 440 CHI: -1.3
Fasta sequence:
>tr|A0A076L2F5|A0A076L2F5_TOBAC|Unreviewed|Nicotiana_tabacum|239
MADPNTIRTIVGIIGNVISFFLFLSPAPTFLKIVKSKSVMEFKPDPYVATVLNCAVWVFY
GMPFVHPDSLLVITINGFGLALELFYVAIFFVYSDWAKRRKIIIALVIEVIFMAILIFVT
LTFLHGTKSRSMLIGIVAIVFNVLMYTSPLTVMKKVITTKSVKYMPFFLSIANFANGIVW
SCYALLKFDPYILIPNGLGTVSGLVQLILYAAFYRTTNWDEDEKEVELSASKTNKSSDV
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 215
Alignment file: A0A076L2F5.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A076L2F5_inward.pdb
Procheck score ⇒ Ramachandran plot: 96.3% favored 2.1% allowed .5% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A076L2F5_outward.pdb
Procheck score ⇒ Ramachandran plot: 95.3% favored 3.7% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A076L2F5_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.7% favored 4.7% allowed 1.6% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA