Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A076L2F5

dbSWEET id: dbswt_893

Accession:   A0A076L2F5

Uniprot status:   Unreviewed

Organism:   Nicotiana tabacum

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Solanales ⇒ Solanaceae ⇒ Nicotianoideae ⇒ Nicotianeae ⇒ Nicotiana.

Sequence Information back to top


Sequence length:   239

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   LNMN           CVV:   440       CHI:   -1.3

Fasta sequence:

>tr|A0A076L2F5|A0A076L2F5_TOBAC|Unreviewed|Nicotiana_tabacum|239
MADPNTIRTIVGIIGNVISFFLFLSPAPTFLKIVKSKSVMEFKPDPYVATVLNCAVWVFY
GMPFVHPDSLLVITINGFGLALELFYVAIFFVYSDWAKRRKIIIALVIEVIFMAILIFVT
LTFLHGTKSRSMLIGIVAIVFNVLMYTSPLTVMKKVITTKSVKYMPFFLSIANFANGIVW
SCYALLKFDPYILIPNGLGTVSGLVQLILYAAFYRTTNWDEDEKEVELSASKTNKSSDV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   215

Alignment file: A0A076L2F5.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A076L2F5_inward.pdb

Procheck score ⇒ Ramachandran plot: 96.3% favored    2.1% allowed    .5% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A076L2F5_outward.pdb

Procheck score ⇒ Ramachandran plot: 95.3% favored    3.7% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A076L2F5_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.7% favored    4.7% allowed    1.6% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur