Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A075HY17
dbSWEET id: dbswt_2039
Accession: A0A075HY17
Uniprot status: Unreviewed
Organism: uncultured marine
Kingdom: Archaea
Sequence Information back to top
Sequence length: 94
Substrate Binding Site: ANAN CVV: 326 CHI: -3.4
Selectivity Filter: GGGG CVV: 192 CHI: -1.6
Fasta sequence:
>tr|A0A075HY17|A0A075HY17_9ARCH|Unreviewed|uncultured marine|94
MELDETTMGVIGIMAGILILSGWVPQIVKGYKTKRLNDVSAYLMILIFAGAVLWLIYGMA
LDDVYIMGVNLAAMVLTMIVLSMKLKYEKATQNK
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 9 Model end: 86 Inward Open: Template: 4X5M.pdb Model structure: A0A075HY17_inward.pdb Alignment file: A0A075HY17_inw.pir Procheck score ⇒ Ramachandran plot: 96.3% favored 3.0% allowed .7% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A075HY17_outward.pdb Alignment file: A0A075HY17_out.pir Procheck score ⇒ Ramachandran plot: 94.0% favored 5.2% allowed .7% week .0% disallowed Occluded: Model structure: A0A075HY17_occluded.pdb Alignment file: A0A075HY17_occ.pir Procheck score ⇒ Ramachandran plot: 96.3% favored 3.7% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA