| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A075G8U1
dbSWEET id: dbswt_2031
Accession: A0A075G8U1
Uniprot status: Unreviewed
Organism: uncultured marine
Kingdom: Archaea
Sequence Information back to top
Sequence length: 97
Substrate Binding Site: ANAN CVV: 326 CHI: -3.4
Selectivity Filter: GGGG CVV: 192 CHI: -1.6
Fasta sequence:
>tr|A0A075G8U1|A0A075G8U1_9ARCH|Unreviewed|uncultured marine|97
MLELDDTMMGIIGILAGILILSGWVPQIAKGYKTKRLNDVSSYLMILIFVGATLWLIYGM
ALDDVYIMGVNLAAMFLTMTVLAMKLKYEKAAQTTSE
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 10 Model end: 87 Inward Open: Template: 4X5M.pdb Model structure: A0A075G8U1_inward.pdb Alignment file: A0A075G8U1_inw.pir Procheck score ⇒ Ramachandran plot: 95.5% favored 3.0% allowed 1.5% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A075G8U1_outward.pdb Alignment file: A0A075G8U1_out.pir Procheck score ⇒ Ramachandran plot: 94.8% favored 3.7% allowed .7% week .7% disallowed Occluded: Model structure: A0A075G8U1_occluded.pdb Alignment file: A0A075G8U1_occ.pir Procheck score ⇒ Ramachandran plot: 94.8% favored 5.2% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA